For laboratory research use only (in vitro). Not for human or animal use.
| Quantity | Discount | Unit Price |
|---|---|---|
| 1-2 units | Standard | $139.99 |
| 3-4 units | 5% off | $132.99 |
| 5-9 units | 10% off | $125.99 |
| 10+ units Best Value | 15% off | $118.99 |
Why researchers choose PBC:
Accepted payment methods:
Certificate of Analysis available upon request. Contact us for lot-specific documentation.
| Amino Acid Sequence | Y(Aib)EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 with C20 fatty diacid at Lys20 |
|---|---|
| Molecular Weight | 4813.45 Da |
| Molecular Formula | C225H348N48O68 |
| CAS Number | 2023788-19-2 |
| Purity | ≥98% (HPLC) |
| Format | Lyophilized Powder |
| Vials Per Kit | 10 |
| Storage | Store at -20C. Reconstituted: 2-8C |
| Research Status | Approved |
For laboratory research use only (in vitro). Not for human or animal use.
Dual Incretin Analog (39-aa) analytical reference compound. Molecular weight 4813.45 Da.
| Sequence | Y(Aib)EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 with C20 fatty diacid at Lys20 |
| Molecular Weight | 4813.45 Da |
| Molecular Formula | C225H348N48O68 |
| CAS | 2023788-19-2 |
| Purity | >=98% (HPLC) |
| Format | Lyophilized powder |
| Storage | Store at -20C. Reconstituted: 2-8C |
For laboratory research use only (in vitro). Not for human or animal use.
| Size | 5mg, 10mg, 20mg, 40mg, 60mg, 80mg, 120mg |
|---|
No published references available for this compound.