Laboratory research materials for in vitro use only.

Prescott Bio Canada

Awaiting product image

GDF-8

For laboratory research use only (in vitro). Not for human or animal use.

$182.99

Volume Pricing

QuantityDiscountUnit Price
1-2 unitsStandard$182.99
3-4 units5% off$173.84
5-9 units10% off$164.69
10+ units Best Value15% off$155.54

Why researchers choose PBC:

  • HPLC-verified purity on every lot
  • Certificate of Analysis included
  • Temperature-controlled shipping
  • Canadian lab — documented supply chain
  • Batch-level traceability

Accepted payment methods:

InteracVisaMCCrypto

Certificate of Analysis available upon request. Contact us for lot-specific documentation.

Product Specifications

Amino Acid Sequence NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Molecular Weight ~25,000 Da (dimer); ~12,500 Da (monomer) Da
Molecular Formula C1237H1927N355O374S10
CAS Number 346693-49-8
Purity ≥98% (HPLC)
Format Lyophilized Powder
Net Quantity 1mg
Vials Per Kit 10
Storage Store at -20C. Reconstituted: 2-8C
Research Status Preclinical

For laboratory research use only (in vitro). Not for human or animal use.

Description

Chemical Identity

GDF-8 analytical reference compound. Molecular weight ~25,000 Da (dimer); ~12,500 Da (monomer) Da.

Specifications

Sequence NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Molecular Weight ~25,000 Da (dimer); ~12,500 Da (monomer) Da
Molecular Formula C1237H1927N355O374S10
CAS 346693-49-8
Purity >=98% (HPLC)
Format Lyophilized powder
Storage Store at -20C. Reconstituted: 2-8C

For laboratory research use only (in vitro). Not for human or animal use.

Published Research

5 references

References are provided for informational purposes to support in vitro laboratory research. No claims are made regarding therapeutic applications.

Regulation of skeletal muscle mass in mice by a new TGF-beta superfamily member

McPherron AC, Lawler AM, Lee SJ (1997). Nature. PubMed 9139826

Myostatin mutation associated with gross muscle hypertrophy in a child

Schuelke M, Wagner KR, Stolz LE, et al. (2004). New England Journal of Medicine. PubMed 15215484

A Phase I/II Trial of MYO-029 in Adult Subjects with Muscular Dystrophy

Wagner KR, Fleckenstein JL, Amato AA, et al. (2008). Annals of Neurology. PubMed 18335515

Double-muscled cattle due to mutations in the myostatin gene

Grobet L, Martin LJ, Poncelet D, et al. (1997). Nature Genetics. PubMed 9288100

Myostatin inhibition in muscle disease: an update on preclinical and clinical data

Smith RC, Lin BK (2013). Current Opinion in Supportive and Palliative Care. PubMed 24157714

For laboratory research use only (in vitro). Not for human or animal use.

Age Verification Required

You must be 19 years of age or older to access this website. This site contains laboratory research materials restricted to qualified personnel.