For laboratory research use only (in vitro). Not for human or animal use.
| Quantity | Discount | Unit Price |
|---|---|---|
| 1-2 units | Standard | $89.99 |
| 3-4 units | 5% off | $85.49 |
| 5-9 units | 10% off | $80.99 |
| 10+ units Best Value | 15% off | $76.49 |
Why researchers choose PBC:
Accepted payment methods:
Certificate of Analysis available upon request. Contact us for lot-specific documentation.
| Amino Acid Sequence | H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG with C18 fatty diacid at Lys26 |
|---|---|
| Molecular Weight | 4113.58 Da |
| Molecular Formula | C187H291N45O59 |
| CAS Number | 910463-68-2 |
| Purity | ≥98% (HPLC) |
| Format | Lyophilized Powder |
| Vials Per Kit | 10 |
| Storage | Store at -20C. Reconstituted: 2-8C |
| Research Status | Approved |
For laboratory research use only (in vitro). Not for human or animal use.
GLP-1 Analog (31-aa) analytical reference compound. Molecular weight 4113.58 Da.
| Sequence | H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG with C18 fatty diacid at Lys26 |
| Molecular Weight | 4113.58 Da |
| Molecular Formula | C187H291N45O59 |
| CAS | 910463-68-2 |
| Purity | >=98% (HPLC) |
| Format | Lyophilized powder |
| Storage | Store at -20C. Reconstituted: 2-8C |
For laboratory research use only (in vitro). Not for human or animal use.
| Size | 2mg, 5mg, 10mg, 15mg, 20mg, 30mg |
|---|
4 references
References are provided for informational purposes to support in vitro laboratory research. No claims are made regarding therapeutic applications.
Glucagon-like peptide 1 promotes satiety and suppresses energy intake in humans
Flint A, Raben A, Astrup A, Holst JJ (1998). Journal of Clinical Investigation. PubMed 9449682
Liraglutide and Cardiovascular Outcomes in Type 2 Diabetes (LEADER)
Marso SP, Daniels GH, Tanaka-Taketomi K, et al. (2016). New England Journal of Medicine. PubMed 27295427
Once-Weekly Semaglutide in Adults with Overweight or Obesity (STEP 1)
Wilding JPH, Batterham RL, Calanna S, et al. (2021). New England Journal of Medicine. PubMed 33567185
Tirzepatide Once Weekly for the Treatment of Obesity (SURMOUNT-1)
Jastreboff AM, Aronne LJ, Ahmad NN, et al. (2022). New England Journal of Medicine. PubMed 35658024
For laboratory research use only (in vitro). Not for human or animal use.