For laboratory research use only (in vitro). Not for human or animal use.
| Quantity | Discount | Unit Price |
|---|---|---|
| 1-2 units | Standard | $88.99 |
| 3-4 units | 5% off | $84.54 |
| 5-9 units | 10% off | $80.09 |
| 10+ units Best Value | 15% off | $75.64 |
Why researchers choose PBC:
Accepted payment methods:
Certificate of Analysis available upon request. Contact us for lot-specific documentation.
| Amino Acid Sequence | [LL-37, 37 aa] |
|---|---|
| Molecular Weight | 4493.33 Da |
| Molecular Formula | C205H340N60O53 |
| CAS Number | 154947-66-7 |
| Purity | ≥98% (HPLC) |
| Format | Lyophilized Powder |
| Net Quantity | 5mg |
| Vials Per Kit | 10 |
| Storage | Store at -20C. Reconstituted: 2-8C |
| Research Status | Phase2 |
For laboratory research use only (in vitro). Not for human or animal use.
LL-37 analytical reference compound. Molecular weight 4493.33 Da.
| Sequence | [LL-37, 37 aa] |
| Molecular Weight | 4493.33 Da |
| Molecular Formula | C205H340N60O53 |
| CAS | 154947-66-7 |
| Purity | >=98% (HPLC) |
| Format | Lyophilized powder |
| Storage | Store at -20C. Reconstituted: 2-8C |
For laboratory research use only (in vitro). Not for human or animal use.
7 references
References are provided for informational purposes to support in vitro laboratory research. No claims are made regarding therapeutic applications.
The peptide antibiotic LL-37/hCAP-18 is expressed in epithelia of the human lung where it has broad antimicrobial activity at the airway surface
Bals R, Wang X, Zasloff M, Wilson JM (1998). Proceedings of the National Academy of Sciences. PubMed 9689116
Activities of LL-37, a cathelin-associated antimicrobial peptide of human neutrophils
Turner J, Cho Y, Dinh NN, Waring AJ, Lehrer RI (1998). Antimicrobial Agents and Chemotherapy. PubMed 9736536
An angiogenic role for the human peptide antibiotic LL-37/hCAP-18
Koczulla R, von Degenfeld G, Kupatt C, et al. (2003). Journal of Clinical Investigation. PubMed 12782669
LL-37 protects rats against lethal sepsis caused by gram-negative bacteria
Cirioni O, Giacometti A, Ghiselli R, et al. (2006). Antimicrobial Agents and Chemotherapy. PubMed 16641434
Oral intake of phenylbutyrate with or without vitamin D3 upregulates the cathelicidin LL-37 in human macrophages
Mily A, Rekha RS, Kamal SM, et al. (2013). BMC Pulmonary Medicine. PubMed 23590701
For laboratory research use only (in vitro). Not for human or animal use.