For laboratory research use only (in vitro). Not for human or animal use.
BACKORDER — 25% Off
| Quantity | Discount | Unit Price |
|---|---|---|
| 1-2 units | Standard | $154.99 |
| 3-4 units | 5% off | $147.24 |
| 5-9 units | 10% off | $139.49 |
| 10+ units Best Value | 15% off | $131.74 |
Why researchers choose PBC:
Accepted payment methods:
Certificate of Analysis available upon request. Contact us for lot-specific documentation.
| Amino Acid Sequence | His(Aib)QGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 with C18 fatty acid at Lys30 |
|---|---|
| Molecular Weight | 4731.41 Da |
| Molecular Formula | C221H342N46O68 |
| CAS Number | 2381089-83-2 |
| Purity | ≥98% (HPLC) |
| Format | Lyophilized Powder |
| Vials Per Kit | 10 |
| Storage | Store at -20C. Reconstituted: 2-8C |
| Research Status | Phase3 |
For laboratory research use only (in vitro). Not for human or animal use.
Retatrutide analytical reference compound. Molecular weight 4731.41 Da.
| Sequence | His(Aib)QGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 with C18 fatty acid at Lys30 |
| Molecular Weight | 4731.41 Da |
| Molecular Formula | C221H342N46O68 |
| CAS | 2381089-83-2 |
| Purity | >=98% (HPLC) |
| Format | Lyophilized powder |
| Storage | Store at -20C. Reconstituted: 2-8C |
For laboratory research use only (in vitro). Not for human or animal use.
| Size | 5mg, 10mg, 15mg, 20mg, 30mg, 40mg |
|---|
3 references
References are provided for informational purposes to support in vitro laboratory research. No claims are made regarding therapeutic applications.
Triple-hormone-receptor agonist retatrutide for obesity – a phase 2 trial
Jastreboff AM, Kaplan LM, Frias JP, et al. (2023). New England Journal of Medicine. PubMed 37366315
Retatrutide, a GIP, GLP-1 and glucagon receptor agonist, for people with type 2 diabetes: a randomised, double-blind, placebo and active-comparator controlled, parallel-group, phase 2 trial conducted in the USA
Rosenstock J, Frias JP, Jastreboff AM, et al. (2023). The Lancet. PubMed 37385280
LY3437943, a novel triple GIP, GLP-1, and glucagon receptor agonist in people with type 2 diabetes: a phase 1, randomised, double-blind, placebo-controlled and active comparator-controlled trial
Coskun T, Urva S, Roell WC, et al. (2022). Cell Metabolism. PubMed 35985340
For laboratory research use only (in vitro). Not for human or animal use.